Lineage for d2y1hb_ (2y1h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084960Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2084961Protein automated matches [190150] (26 species)
    not a true protein
  7. 2085032Species Human (Homo sapiens) [TaxId:9606] [189102] (6 PDB entries)
  8. 2085041Domain d2y1hb_: 2y1h B: [196393]
    Other proteins in same PDB: d2y1ha2
    automated match to d2gzxa_
    complexed with edo, ni, po4, zn

Details for d2y1hb_

PDB Entry: 2y1h (more details), 2.5 Å

PDB Description: Crystal structure of the human TatD-domain protein 3 (TATDN3)
PDB Compounds: (B:) putative deoxyribonuclease tatdn3

SCOPe Domain Sequences for d2y1hb_:

Sequence, based on SEQRES records: (download)

>d2y1hb_ c.1.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvglvdchchlsapdfdrdlddvlekakkanvvalvavaehsgefekimqlseryngfvl
pclgvhpvqglppedqrsvtlkdldvalpiienykdrllaigevgldfsprfagtgeqke
eqrqvlirqiqlakrlnlpvnvhsrsagrptinllqeqgaekvllhafdgrpsvamegvr
agyffsippsiirsgqkqklvkqlpltsicletdspalgpekqvrnepwnisisaeyiaq
vkgisveevievttqnalklfpklrhll

Sequence, based on observed residues (ATOM records): (download)

>d2y1hb_ c.1.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvglvdchchlsapdfdrdlddvlekakkanvvalvavaehsgefekimqlseryngfvl
pclgvhpvqgldqrsvtlkdldvalpiienykdrllaigevgldfsprfagtgeqkeeqr
qvlirqiqlakrlnlpvnvhsrsagrptinllqeqgaekvllhafdgrpsvamegvragy
ffsippsiirsgqkqklvkqlpltsicletdspalgpekqvrnepwnisisaeyiaqvkg
isveevievttqnalklfpklrhll

SCOPe Domain Coordinates for d2y1hb_:

Click to download the PDB-style file with coordinates for d2y1hb_.
(The format of our PDB-style files is described here.)

Timeline for d2y1hb_: