Lineage for d3q1ya1 (3q1y A:2-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904767Species Listeria innocua [TaxId:1642] [196383] (4 PDB entries)
  8. 2904769Domain d3q1ya1: 3q1y A:2-309 [196384]
    Other proteins in same PDB: d3q1ya2
    automated match to d2jg5a_
    complexed with gol, k

Details for d3q1ya1

PDB Entry: 3q1y (more details), 2.03 Å

PDB Description: allosteric regulation by lysine residue: a novel anion-hole formation in the ribokinase family
PDB Compounds: (A:) Lin2199 protein

SCOPe Domain Sequences for d3q1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q1ya1 c.72.1.0 (A:2-309) automated matches {Listeria innocua [TaxId: 1642]}
iytitlnpaidrllfirgelekrktnrviktefdcggkglhvsgvlskfgiknealgiag
sdnldklyailkekhinhdflveagtstrecfvvlsddtngstmipeagftvsqtnkdnl
lkqiakkvkkedmvviagsppphytlsdfkellrtvkatgaflgcdnsgeylnlavemgv
dfikpnedeviaildektnsleenirtlaekipylvvslgakgsicahngklyqvippkv
qerndtgagdvfvgafiaglamnmpitetlkvatgcsasavmqqdsssfdleaagklknq
vsiiqlee

SCOPe Domain Coordinates for d3q1ya1:

Click to download the PDB-style file with coordinates for d3q1ya1.
(The format of our PDB-style files is described here.)

Timeline for d3q1ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q1ya2