| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
| Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
| Protein automated matches [190117] (50 species) not a true protein |
| Species Listeria innocua [TaxId:1642] [196383] (4 PDB entries) |
| Domain d3q1ya1: 3q1y A:2-309 [196384] Other proteins in same PDB: d3q1ya2 automated match to d2jg5a_ complexed with gol, k |
PDB Entry: 3q1y (more details), 2.03 Å
SCOPe Domain Sequences for d3q1ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q1ya1 c.72.1.0 (A:2-309) automated matches {Listeria innocua [TaxId: 1642]}
iytitlnpaidrllfirgelekrktnrviktefdcggkglhvsgvlskfgiknealgiag
sdnldklyailkekhinhdflveagtstrecfvvlsddtngstmipeagftvsqtnkdnl
lkqiakkvkkedmvviagsppphytlsdfkellrtvkatgaflgcdnsgeylnlavemgv
dfikpnedeviaildektnsleenirtlaekipylvvslgakgsicahngklyqvippkv
qerndtgagdvfvgafiaglamnmpitetlkvatgcsasavmqqdsssfdleaagklknq
vsiiqlee
Timeline for d3q1ya1: