SCOPe 2.08: Domain d3q1ya1: 3q1y A:2-309

Lineage for d3q1ya1 (3q1y A:2-309)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Listeria innocua [TaxId:1642] [196383] (4 PDB entries)

8. Domain d3q1ya1: 3q1y A:2-309 [196384]
   Other proteins in same PDB: d3q1ya2
   automated match to d2jg5a_
   complexed with gol, k

Details for d3q1ya1

PDB Entry: 3q1y, 2.03 Å

PDB Description: allosteric regulation by lysine residue: a novel anion-hole formation in the ribokinase family

PDB Compounds: (A:) Lin2199 protein

SCOPe Domain Sequences for d3q1ya1:

Sequence; same for both SEQRES and ATOM records:

>d3q1ya1 c.72.1.0 (A:2-309) automated matches {Listeria innocua [TaxId: 1642]}
iytitlnpaidrllfirgelekrktnrviktefdcggkglhvsgvlskfgiknealgiag
sdnldklyailkekhinhdflveagtstrecfvvlsddtngstmipeagftvsqtnkdnl
lkqiakkvkkedmvviagsppphytlsdfkellrtvkatgaflgcdnsgeylnlavemgv
dfikpnedeviaildektnsleenirtlaekipylvvslgakgsicahngklyqvippkv
qerndtgagdvfvgafiaglamnmpitetlkvatgcsasavmqqdsssfdleaagklknq
vsiiqlee

Timeline for d3q1ya1:

• d3q1ya1 first appeared in SCOPe 2.02, called d3q1ya_
  
• d3q1ya1 appears in SCOPe 2.07