![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies) not a true fold |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (9 PDB entries) |
![]() | Domain d1b9xb_: 1b9x B: [19638] Other proteins in same PDB: d1b9xa_, d1b9xc_ complexed with gd; mutant |
PDB Entry: 1b9x (more details), 3 Å
SCOP Domain Sequences for d1b9xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9xb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)} mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped knpfkelk
Timeline for d1b9xb_: