Class a: All alpha proteins [46456] (144 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies) |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48673] (8 PDB entries) |
Domain d1b9xb_: 1b9x B: [19638] Other proteins in same PDB: d1b9xa_, d1b9xc_ |
PDB Entry: 1b9x (more details), 3 Å
SCOP Domain Sequences for d1b9xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9xb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)} mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped knpfkelk
Timeline for d1b9xb_: