Lineage for d1b9xb_ (1b9x B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51411Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies)
  4. 51433Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
  5. 51434Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 51435Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 51436Species Cow (Bos taurus) [TaxId:9913] [48673] (8 PDB entries)
  8. 51445Domain d1b9xb_: 1b9x B: [19638]
    Other proteins in same PDB: d1b9xa_, d1b9xc_

Details for d1b9xb_

PDB Entry: 1b9x (more details), 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin

SCOP Domain Sequences for d1b9xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9xb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk

SCOP Domain Coordinates for d1b9xb_:

Click to download the PDB-style file with coordinates for d1b9xb_.
(The format of our PDB-style files is described here.)

Timeline for d1b9xb_: