Lineage for d1b9yb_ (1b9y B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649538Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
    not a true fold
  4. 649588Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
  5. 649589Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 649590Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 649591Species Cow (Bos taurus) [TaxId:9913] [48673] (11 PDB entries)
  8. 649602Domain d1b9yb_: 1b9y B: [19637]
    Other proteins in same PDB: d1b9ya_, d1b9yc_
    complexed with gd

Details for d1b9yb_

PDB Entry: 1b9y (more details), 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma
PDB Compounds: (B:) protein (transducin)

SCOP Domain Sequences for d1b9yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9yb_ a.137.3.1 (B:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk

SCOP Domain Coordinates for d1b9yb_:

Click to download the PDB-style file with coordinates for d1b9yb_.
(The format of our PDB-style files is described here.)

Timeline for d1b9yb_: