SCOPe 2.08: Domain d3mimb1: 3mim B:1001-1099

Lineage for d3mimb1 (3mim B:1001-1099)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d3mimb1: 3mim B:1001-1099 [196364]
   Other proteins in same PDB: d3mimb2
   automated match to d1qbra_

Details for d3mimb1

PDB Entry: 3mim, 1.76 Å

PDB Description: x-ray snapshot of hiv-1 protease in action: observation of tetrahedral intermediate and its sihb with catalytic aspartate

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3mimb1:

Sequence; same for both SEQRES and ATOM records:

>d3mimb1 b.50.1.1 (B:1001-1099) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d3mimb1:

• d3mimb1 first appeared in SCOPe 2.02, called d3mimb_
  
• d3mimb1 appears in SCOPe 2.07