SCOPe 2.06: Domain d1gg2g_: 1gg2 G:

Lineage for d1gg2g_ (1gg2 G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (28 PDB entries)

8. Domain d1gg2g_: 1gg2 G: [19636]
   Other proteins in same PDB: d1gg2a1, d1gg2a2, d1gg2b_
   complexed with gdp; mutant

Details for d1gg2g_

PDB Entry: 1gg2, 2.4 Å

PDB Description: g protein heterotrimer mutant gi_alpha_1(g203a) beta_1 gamma_2 with gdp bound

PDB Compounds: (G:) g protein gi gamma 2

SCOPe Domain Sequences for d1gg2g_:

Sequence; same for both SEQRES and ATOM records:

>d1gg2g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpf

Timeline for d1gg2g_:

• d1gg2g_ first appeared (with stable ids) in SCOP 1.55
  
• d1gg2g_ appears in SCOPe 2.05
  
• d1gg2g_ appears in SCOPe 2.07
  
• d1gg2g_ appears in the current release, SCOPe 2.08