![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies) not a true fold |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (9 PDB entries) |
![]() | Domain d1gg2g_: 1gg2 G: [19636] Other proteins in same PDB: d1gg2a1, d1gg2a2, d1gg2b_ complexed with gdp; mutant |
PDB Entry: 1gg2 (more details), 2.4 Å
SCOP Domain Sequences for d1gg2g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gg2g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)} siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpf
Timeline for d1gg2g_: