Lineage for d3aupd_ (3aup D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2393810Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2393811Protein automated matches [190954] (11 species)
    not a true protein
  7. 2393874Species Soybean (Glycine max) [TaxId:3847] [196358] (1 PDB entry)
  8. 2393878Domain d3aupd_: 3aup D: [196359]
    automated match to d3hd8a_

Details for d3aupd_

PDB Entry: 3aup (more details), 1.91 Å

PDB Description: crystal structure of basic 7s globulin from soybean
PDB Compounds: (D:) Basic 7S globulin

SCOPe Domain Sequences for d3aupd_:

Sequence, based on SEQRES records: (download)

>d3aupd_ b.50.1.0 (D:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
pinlvvlpvqndgstglhwanlqkrtplmqvpvlvdlngnhlwvnceqqyssktyqapfc
hstqcsranthqclscpaasrpgchkntcglmstnpitqqtglgelgedvlaihatqgst
qqlgplvtvpqflfscapsflvqkglprntqgvaglghapislpnqlashfglqrqfttc
lsryptskgaiifgdapnnmrqfqnqdifhdlaftpltitlqgeynvrvnsirinqhsvf
plnkisstivgstsggtmiststphmvlqqsvyqaftqvfaqqlpkqaqvksvapfglcf
nsnkinaypsvdlvmdkpngpvwrisgedlmvqaqpgvtclgvmnggmqpraeitlgarq
leenlvvfdlarsrvgfstsslhshgvkcadlfnf

Sequence, based on observed residues (ATOM records): (download)

>d3aupd_ b.50.1.0 (D:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
pinlvvlpvqndgstglhwanlqkrtplmqvpvlvdlngnhlwvnceqqyssktyqapfc
hstqcsranthqclscpaasrpgchkntcglmstnpitqqtglgelgedvlaihatgplv
tvpqflfscapsflvqkglprntqgvaglghapislpnqlashfglqrqfttclsrypts
kgaiifgdapnnmifhdlaftpltitlqgeynvrvnsirinqhsvfpstivgstsggtmi
ststphmvlqqsvyqaftqvfaqqlpvksvapfglcfnsaypsvdlvmdkpngpvwrisg
edlmvqatclgvmnggmqpraeitlgarqleenlvvfdlarsrvgfstshgvkcadlfnf

SCOPe Domain Coordinates for d3aupd_:

Click to download the PDB-style file with coordinates for d3aupd_.
(The format of our PDB-style files is described here.)

Timeline for d3aupd_: