SCOPe 2.05: Domain d3qfqe_: 3qfq E:

Lineage for d3qfqe_ (3qfq E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.0: automated matches [191630] (1 protein)
   not a true family

6. Protein automated matches [191159] (2 species)
   not a true protein

7. Species Merkel cell polyomavirus [TaxId:493803] [196355] (1 PDB entry)

8. Domain d3qfqe_: 3qfq E: [196356]
   automated match to d2itlb_
   protein/DNA complex

Details for d3qfqe_

PDB Entry: 3qfq, 2.9 Å

PDB Description: Asymmetric Assembly of Merkel Cell Polyomavirus Large T-antigen Origin Binding Domains at the Viral Origin

PDB Compounds: (E:) large t antigen

SCOPe Domain Sequences for d3qfqe_:

Sequence; same for both SEQRES and ATOM records:

>d3qfqe_ d.89.1.0 (E:) automated matches {Merkel cell polyomavirus [TaxId: 493803]}
vptdfpidlsdylshavysnktvscfaiyttsdkaielydkiekfkvdfksrhacelgci
llfitlskhrvsaiknfcstfctisflickgvnkmpemynnlckppykllqenkpll

Timeline for d3qfqe_:

• d3qfqe_ first appeared in SCOPe 2.02
  
• d3qfqe_ appears in SCOPe 2.04
  
• d3qfqe_ appears in SCOPe 2.06
  
• d3qfqe_ appears in the current release, SCOPe 2.08