Lineage for d3qfqe_ (3qfq E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963164Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2963165Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2963262Family d.89.1.0: automated matches [191630] (1 protein)
    not a true family
  6. 2963263Protein automated matches [191159] (3 species)
    not a true protein
  7. 2963269Species Merkel cell polyomavirus [TaxId:493803] [196355] (1 PDB entry)
  8. 2963270Domain d3qfqe_: 3qfq E: [196356]
    automated match to d2itlb_
    protein/DNA complex

Details for d3qfqe_

PDB Entry: 3qfq (more details), 2.9 Å

PDB Description: Asymmetric Assembly of Merkel Cell Polyomavirus Large T-antigen Origin Binding Domains at the Viral Origin
PDB Compounds: (E:) large t antigen

SCOPe Domain Sequences for d3qfqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfqe_ d.89.1.0 (E:) automated matches {Merkel cell polyomavirus [TaxId: 493803]}
vptdfpidlsdylshavysnktvscfaiyttsdkaielydkiekfkvdfksrhacelgci
llfitlskhrvsaiknfcstfctisflickgvnkmpemynnlckppykllqenkpll

SCOPe Domain Coordinates for d3qfqe_:

Click to download the PDB-style file with coordinates for d3qfqe_.
(The format of our PDB-style files is described here.)

Timeline for d3qfqe_: