Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily) alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325 |
Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) |
Family d.89.1.0: automated matches [191630] (1 protein) not a true family |
Protein automated matches [191159] (3 species) not a true protein |
Species Merkel cell polyomavirus [TaxId:493803] [196355] (1 PDB entry) |
Domain d3qfqe_: 3qfq E: [196356] automated match to d2itlb_ protein/DNA complex |
PDB Entry: 3qfq (more details), 2.9 Å
SCOPe Domain Sequences for d3qfqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qfqe_ d.89.1.0 (E:) automated matches {Merkel cell polyomavirus [TaxId: 493803]} vptdfpidlsdylshavysnktvscfaiyttsdkaielydkiekfkvdfksrhacelgci llfitlskhrvsaiknfcstfctisflickgvnkmpemynnlckppykllqenkpll
Timeline for d3qfqe_: