Lineage for d3qqqa_ (3qqq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688822Species Trema tomentosa [TaxId:3480] [196352] (1 PDB entry)
  8. 2688823Domain d3qqqa_: 3qqq A: [196354]
    automated match to d2oifg_
    complexed with hem, so4

Details for d3qqqa_

PDB Entry: 3qqq (more details), 1.84 Å

PDB Description: Crystal structure of non-symbiotic plant hemoglobin from Trema tomentosa
PDB Compounds: (A:) non-symbiotic hemoglobin

SCOPe Domain Sequences for d3qqqa_:

Sequence, based on SEQRES records: (download)

>d3qqqa_ a.1.1.2 (A:) automated matches {Trema tomentosa [TaxId: 3480]}
vfteeqealvvkswavmkknsaelglkfflkifeiapsaknlfsylkdspipleqnpklk
phamtvfvmtcesavqlrkagkvtvresnlkrlgaihfkngvvnehfevtrfalletike
avpemwspemknawgeaydqlvaaiksemkp

Sequence, based on observed residues (ATOM records): (download)

>d3qqqa_ a.1.1.2 (A:) automated matches {Trema tomentosa [TaxId: 3480]}
vfteeqealvvkswavmkknsaelglkfflkifeiapsaknlfsylkspipleqnpklkp
hamtvfvmtcesavqlrkagkvtvresnlkrlgaihfkngvvnehfevtrfalletikea
vpemwspemknawgeaydqlvaaiksemkp

SCOPe Domain Coordinates for d3qqqa_:

Click to download the PDB-style file with coordinates for d3qqqa_.
(The format of our PDB-style files is described here.)

Timeline for d3qqqa_: