Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Trema tomentosa [TaxId:3480] [196352] (1 PDB entry) |
Domain d3qqqa_: 3qqq A: [196354] automated match to d2oifg_ complexed with hem, so4 |
PDB Entry: 3qqq (more details), 1.84 Å
SCOPe Domain Sequences for d3qqqa_:
Sequence, based on SEQRES records: (download)
>d3qqqa_ a.1.1.2 (A:) automated matches {Trema tomentosa [TaxId: 3480]} vfteeqealvvkswavmkknsaelglkfflkifeiapsaknlfsylkdspipleqnpklk phamtvfvmtcesavqlrkagkvtvresnlkrlgaihfkngvvnehfevtrfalletike avpemwspemknawgeaydqlvaaiksemkp
>d3qqqa_ a.1.1.2 (A:) automated matches {Trema tomentosa [TaxId: 3480]} vfteeqealvvkswavmkknsaelglkfflkifeiapsaknlfsylkspipleqnpklkp hamtvfvmtcesavqlrkagkvtvresnlkrlgaihfkngvvnehfevtrfalletikea vpemwspemknawgeaydqlvaaiksemkp
Timeline for d3qqqa_: