SCOPe 2.03: Domain d3q6xb_: 3q6x B:

Lineage for d3q6xb_ (3q6x B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (8 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (16 PDB entries)

8. Domain d3q6xb_: 3q6x B: [196349]
   automated match to d3srxa_
   complexed with gol, zn, zz7

Details for d3q6xb_

PDB Entry: 3q6x, 1.3 Å

PDB Description: crystal structure of ndm-1 in complex with hydrolyzed ampicillin

PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3q6xb_:

Sequence; same for both SEQRES and ATOM records:

>d3q6xb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

Timeline for d3q6xb_:

• d3q6xb_ first appeared in SCOPe 2.02
  
• d3q6xb_ appears in SCOPe 2.04
  
• d3q6xb_ last appears in SCOPe 2.07