Lineage for d3q6xb_ (3q6x B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224808Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1224809Protein automated matches [190418] (5 species)
    not a true protein
  7. 1224814Species Klebsiella pneumoniae [TaxId:573] [189718] (11 PDB entries)
  8. 1224815Domain d3q6xb_: 3q6x B: [196349]
    automated match to d3srxa_
    complexed with gol, zn, zz7

Details for d3q6xb_

PDB Entry: 3q6x (more details), 1.3 Å

PDB Description: crystal structure of ndm-1 in complex with hydrolyzed ampicillin
PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3q6xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6xb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

SCOPe Domain Coordinates for d3q6xb_:

Click to download the PDB-style file with coordinates for d3q6xb_.
(The format of our PDB-style files is described here.)

Timeline for d3q6xb_: