Lineage for d3qrjb1 (3qrj B:246-497)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (770 PDB entries)
  8. 2545362Domain d3qrjb1: 3qrj B:246-497 [196348]
    Other proteins in same PDB: d3qrja2, d3qrjb2
    automated match to d2gqga_
    complexed with 919; mutant

Details for d3qrjb1

PDB Entry: 3qrj (more details), 1.82 Å

PDB Description: The crystal structure of human abl1 kinase domain T315I mutant in complex with DCC-2036
PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3qrjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qrjb1 d.144.1.7 (B:246-497) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvc
treppfyiiiefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdla
arnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwaf
gvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrps
faeihqafetmf

SCOPe Domain Coordinates for d3qrjb1:

Click to download the PDB-style file with coordinates for d3qrjb1.
(The format of our PDB-style files is described here.)

Timeline for d3qrjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qrjb2