Lineage for d3rhcb_ (3rhc B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370822Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (3 PDB entries)
  8. 1370826Domain d3rhcb_: 3rhc B: [196345]
    automated match to d3fz9a_
    complexed with fes, gsh

Details for d3rhcb_

PDB Entry: 3rhc (more details), 2.4 Å

PDB Description: Crystal structure of the holo form of glutaredoxin C5 from Arabidopsis thaliana
PDB Compounds: (B:) Glutaredoxin-C5, chloroplastic

SCOPe Domain Sequences for d3rhcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhcb_ c.47.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
srmeesirktvtentvviysktwcsyctevktlfkrlgvqplvveldqlgpqgpqlqkvl
erltgqhtvpnvfvcgkhiggctdtvklnrkgdlelmlae

SCOPe Domain Coordinates for d3rhcb_:

Click to download the PDB-style file with coordinates for d3rhcb_.
(The format of our PDB-style files is described here.)

Timeline for d3rhcb_: