![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies) not a true fold |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (9 PDB entries) |
![]() | Domain d2trcg_: 2trc G: [19634] Other proteins in same PDB: d2trcb_, d2trcp_ complexed with gd |
PDB Entry: 2trc (more details), 2.4 Å
SCOP Domain Sequences for d2trcg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2trcg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)} mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped knpfkelk
Timeline for d2trcg_: