Lineage for d2trcg_ (2trc G:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156940Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
  4. 156967Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
  5. 156968Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 156969Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 156970Species Cow (Bos taurus) [TaxId:9913] [48673] (8 PDB entries)
  8. 156975Domain d2trcg_: 2trc G: [19634]
    Other proteins in same PDB: d2trcb_, d2trcp_

Details for d2trcg_

PDB Entry: 2trc (more details), 2.4 Å

PDB Description: phosducin/transducin beta-gamma complex

SCOP Domain Sequences for d2trcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2trcg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
mpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfkelk

SCOP Domain Coordinates for d2trcg_:

Click to download the PDB-style file with coordinates for d2trcg_.
(The format of our PDB-style files is described here.)

Timeline for d2trcg_: