Lineage for d3r9xb_ (3r9x B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146636Species Aquifex aeolicus [TaxId:63363] [196336] (1 PDB entry)
  8. 2146637Domain d3r9xb_: 3r9x B: [196337]
    automated match to d3tqsa_
    protein/RNA complex; complexed with act, gnp, mg, mrd

Details for d3r9xb_

PDB Entry: 3r9x (more details), 2.8 Å

PDB Description: Crystal structure of Era in complex with MgGDPNP, nucleotides 1506-1542 of 16S ribosomal RNA, and KsgA
PDB Compounds: (B:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d3r9xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9xb_ c.66.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
lvsegvlkkiaeelnieegntvvevgggtgnltkvllqhplkklyvieldremvenlksi
gderlevinedaskfpfcslgkelkvvgnlpynvasliientvynkdcvplavfmvqkev
aeklqgkkdtgwlsvfvrtfydvnyvmtvpprffvpppkvqsaviklvknekfpvkdlkn
ykkfltkifqnrrkvlrkkipeellkeaginpdarveqlsledffklyrliedsg

SCOPe Domain Coordinates for d3r9xb_:

Click to download the PDB-style file with coordinates for d3r9xb_.
(The format of our PDB-style files is described here.)

Timeline for d3r9xb_: