SCOPe 2.02: Domain d3nl1a_: 3nl1 A:

Lineage for d3nl1a_ (3nl1 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer

6. Protein automated matches [190924] (1 species)
   not a true protein

7. Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (5 PDB entries)

8. Domain d3nl1a_: 3nl1 A: [196332]
   automated match to d2phdb_
   complexed with fe2, gol, gtq

Details for d3nl1a_

PDB Entry: 3nl1, 2.15 Å

PDB Description: Crystal Structure of Salicylate 1,2-dioxygenase from Pseudoaminobacter salicylatoxidans Adducts with gentisate

PDB Compounds: (A:) Gentisate 1,2-dioxygenase

SCOPe Domain Sequences for d3nl1a_:

Sequence; same for both SEQRES and ATOM records:

>d3nl1a_ b.82.1.23 (A:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
qnekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkw
stllrlarksgelvpvgrggerralglanpglggnayisptmwagiqylgpretapehrh
sqnafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfs
qqmdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdra
lteqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgst
vfqvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmr
tkiegq

Timeline for d3nl1a_:

• d3nl1a_ is new in SCOPe 2.02-stable
  
• d3nl1a_ appears in SCOPe 2.03
  
• d3nl1a_ appears in the current release, SCOPe 2.08