SCOP 1.75: Domain d1tbgh_: 1tbg H:

Lineage for d1tbgh_ (1tbg H:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (11 PDB entries)

8. Domain d1tbgh_: 1tbg H: [19633]
   Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_

Details for d1tbgh_

PDB Entry: 1tbg, 2.1 Å

PDB Description: beta-gamma dimer of the heterotrimeric g-protein transducin

PDB Compounds: (H:) transducin

SCOP Domain Sequences for d1tbgh_:

Sequence; same for both SEQRES and ATOM records:

>d1tbgh_ a.137.3.1 (H:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfk

Timeline for d1tbgh_:

• d1tbgh_ first appeared (with stable ids) in SCOP 1.55
  
• d1tbgh_ appears in SCOP 1.73
  
• d1tbgh_ appears in SCOPe 2.01
  
• d1tbgh_ appears in the current release, SCOPe 2.08