Lineage for d3sbwb_ (3sbw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741861Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 2741888Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries)
  8. 2741895Domain d3sbwb_: 3sbw B: [196327]
    automated match to d1npua_
    mutant

Details for d3sbwb_

PDB Entry: 3sbw (more details), 2.28 Å

PDB Description: crystal structure of the complex between the extracellular domains of mouse pd-1 mutant and human pd-l1
PDB Compounds: (B:) Programmed cell death protein 1

SCOPe Domain Sequences for d3sbwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbwb_ b.1.1.1 (B:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvt

SCOPe Domain Coordinates for d3sbwb_:

Click to download the PDB-style file with coordinates for d3sbwb_.
(The format of our PDB-style files is described here.)

Timeline for d3sbwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3sbwa_