Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (9 species) not a true protein |
Species Serratia fonticola [TaxId:47917] [196325] (3 PDB entries) |
Domain d3sd9b_: 3sd9 B: [196326] automated match to d3f9oa_ complexed with zn |
PDB Entry: 3sd9 (more details), 1.83 Å
SCOPe Domain Sequences for d3sd9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sd9b_ d.157.1.1 (B:) automated matches {Serratia fonticola [TaxId: 47917]} knltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplp inevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnlek slpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanr teypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekap
Timeline for d3sd9b_: