Lineage for d1vtnc_ (1vtn C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2305937Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2305958Protein automated matches [190243] (2 species)
    not a true protein
  7. 2305959Species Human (Homo sapiens) [TaxId:9606] [187016] (8 PDB entries)
  8. 2305964Domain d1vtnc_: 1vtn C: [196324]
    automated match to d1d5va_
    protein/DNA complex; complexed with mg

Details for d1vtnc_

PDB Entry: 1vtn (more details), 2.5 Å

PDB Description: co-crystal structure of the hnf-3/fork head dna-recognition motif resembles histone h5
PDB Compounds: (C:) hnf-3/fork head DNA-recognition motif

SCOPe Domain Sequences for d1vtnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vtnc_ a.4.5.14 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hakppysyislitmaiqqapgkmltlseiyqwimdlfpyyrenqqrwqnsirhslsfndc
fvkvarspdkpgkgsywalhpssgnmfengcylrrqkrfkla

SCOPe Domain Coordinates for d1vtnc_:

Click to download the PDB-style file with coordinates for d1vtnc_.
(The format of our PDB-style files is described here.)

Timeline for d1vtnc_: