| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins) |
| Protein automated matches [190243] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries) |
| Domain d1vtnc1: 1vtn C:117-217 [196324] Other proteins in same PDB: d1vtnc2 automated match to d1d5va_ protein/DNA complex; complexed with mg |
PDB Entry: 1vtn (more details), 2.5 Å
SCOPe Domain Sequences for d1vtnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vtnc1 a.4.5.14 (C:117-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hakppysyislitmaiqqapgkmltlseiyqwimdlfpyyrenqqrwqnsirhslsfndc
fvkvarspdkpgkgsywalhpssgnmfengcylrrqkrfkl
Timeline for d1vtnc1: