Lineage for d1tbgg_ (1tbg G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016391Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2016392Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. 2016393Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2016394Species Cow (Bos taurus) [TaxId:9913] [48673] (28 PDB entries)
  8. 2016398Domain d1tbgg_: 1tbg G: [19632]
    Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_

Details for d1tbgg_

PDB Entry: 1tbg (more details), 2.1 Å

PDB Description: beta-gamma dimer of the heterotrimeric g-protein transducin
PDB Compounds: (G:) transducin

SCOPe Domain Sequences for d1tbgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbgg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfk

SCOPe Domain Coordinates for d1tbgg_:

Click to download the PDB-style file with coordinates for d1tbgg_.
(The format of our PDB-style files is described here.)

Timeline for d1tbgg_: