Lineage for d1tbgg_ (1tbg G:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778426Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
  5. 778427Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 778428Protein Transducin (heterotrimeric G protein), gamma chain [48672] (2 species)
  7. 778429Species Cow (Bos taurus) [TaxId:9913] [48673] (11 PDB entries)
  8. 778432Domain d1tbgg_: 1tbg G: [19632]
    Other proteins in same PDB: d1tbga_, d1tbgb_, d1tbgc_, d1tbgd_

Details for d1tbgg_

PDB Entry: 1tbg (more details), 2.1 Å

PDB Description: beta-gamma dimer of the heterotrimeric g-protein transducin
PDB Compounds: (G:) transducin

SCOP Domain Sequences for d1tbgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbgg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgiped
knpfk

SCOP Domain Coordinates for d1tbgg_:

Click to download the PDB-style file with coordinates for d1tbgg_.
(The format of our PDB-style files is described here.)

Timeline for d1tbgg_: