SCOPe 2.06: Domain d3sm4c1: 3sm4 C:1-226

Lineage for d3sm4c1 (3sm4 C:1-226)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.13: lambda exonuclease [53017] (1 protein)

6. Protein lambda exonuclease [53018] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [53019] (3 PDB entries)

8. Domain d3sm4c1: 3sm4 C:1-226 [196309]
   Other proteins in same PDB: d3sm4b2, d3sm4c2
   automated match to d1avqa_
   protein/DNA complex; complexed with cl, mg, po4; mutant

Details for d3sm4c1

PDB Entry: 3sm4, 1.88 Å

PDB Description: crystal structure of the k131a mutant of lambda exonuclease in complex with a 5'-phosphorylated 14-mer/12-mer duplex and magnesium

PDB Compounds: (C:) Exonuclease

SCOPe Domain Sequences for d3sm4c1:

Sequence; same for both SEQRES and ATOM records:

>d3sm4c1 c.52.1.13 (C:1-226) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]}
mtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyfht
llaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacspdg
lcsdgnglelacpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydprmk
reglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

Timeline for d3sm4c1:

• d3sm4c1 first appeared in SCOPe 2.02, called d3sm4c_
  
• d3sm4c1 was called d3sm4c_ in SCOPe 2.05
  
• d3sm4c1 appears in SCOPe 2.07
  
• d3sm4c1 appears in the current release, SCOPe 2.08