SCOPe 2.05: Domain d3sm4c_: 3sm4 C:

Lineage for d3sm4c_ (3sm4 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.13: lambda exonuclease [53017] (1 protein)

6. Protein lambda exonuclease [53018] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [53019] (3 PDB entries)

8. Domain d3sm4c_: 3sm4 C: [196309]
   automated match to d1avqa_
   protein/DNA complex; complexed with cl, mg, po4; mutant

Details for d3sm4c_

PDB Entry: 3sm4, 1.88 Å

PDB Description: crystal structure of the k131a mutant of lambda exonuclease in complex with a 5'-phosphorylated 14-mer/12-mer duplex and magnesium

PDB Compounds: (C:) Exonuclease

SCOPe Domain Sequences for d3sm4c_:

Sequence; same for both SEQRES and ATOM records:

>d3sm4c_ c.52.1.13 (C:) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]}
gshmtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsy
fhtllaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacs
pdglcsdgnglelacpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydp
rmkreglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

Timeline for d3sm4c_:

• d3sm4c_ first appeared in SCOPe 2.02
  
• d3sm4c_ appears in SCOPe 2.04
  
• d3sm4c_ is called d3sm4c1 in SCOPe 2.06
  
• d3sm4c_ appears in the current release, SCOPe 2.08, called d3sm4c1