Lineage for d3ntlb_ (3ntl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128137Family c.60.1.2: Histidine acid phosphatase [53258] (4 protein domains)
  6. 2128187Protein automated matches [196302] (3 species)
    not a true protein
  7. 2128191Species Enterobacter cloacae [TaxId:550] [196303] (1 PDB entry)
  8. 2128193Domain d3ntlb_: 3ntl B: [196304]
    Other proteins in same PDB: d3ntla2
    automated match to d1nt4a_
    complexed with ca, ihp, po4

Details for d3ntlb_

PDB Entry: 3ntl (more details), 1.88 Å

PDB Description: Crystal Structure of Glucose-1-phosphatase (AgpE) from Enterobacter cloacae
PDB Compounds: (B:) Acid glucose-1-phosphate phosphatase

SCOPe Domain Sequences for d3ntlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ntlb_ c.60.1.2 (B:) automated matches {Enterobacter cloacae [TaxId: 550]}
egyqleqvlimsranlraplanngsvleqstpkqwpewevpggqlttkggvlevymghym
rewlaqqgmvktgecpaadsvyayanslqrtvataqffitgafpgcdvpvhhqekmgtmd
ptfnpvitdnspefrekalkameterqkmqltesyklleqmtnyadspsckekkvcslad
akdtfsadyekepgvsgplkvgnslvdaftlqyyegfpadqvawgeiktdqqwrvlsklk
ngyqdslftstevaqnvakplvkyidktlvteqakapkitllvghdsniaslltaldfkp
yqlhdqqertpiggkivfqrwhdknanqelmkieyvyqsseqlrnasvlslqspaqrvtl
elkgcpvdangfcpvdkfnavmnnaak

SCOPe Domain Coordinates for d3ntlb_:

Click to download the PDB-style file with coordinates for d3ntlb_.
(The format of our PDB-style files is described here.)

Timeline for d3ntlb_: