Lineage for d3o15a_ (3o15 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091291Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) (S)
    automatically mapped to Pfam PF02581
  5. 2091292Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins)
  6. 2091293Protein Thiamin phosphate synthase [51393] (2 species)
  7. 2091294Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries)
  8. 2091309Domain d3o15a_: 3o15 A: [196301]
    automated match to d2tpsb_
    complexed with 3nm, ifp, pop

Details for d3o15a_

PDB Entry: 3o15 (more details), 1.95 Å

PDB Description: crystal structure of bacillus subtilis thiamin phosphate synthase complexed with a carboxylated thiazole phosphate
PDB Compounds: (A:) Thiamine-phosphate pyrophosphorylase

SCOPe Domain Sequences for d3o15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o15a_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
trisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearikf
aekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvsahtm
sevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggitidna
apviqagadgvsmisaisqaedpesaarkfreeiqtykt

SCOPe Domain Coordinates for d3o15a_:

Click to download the PDB-style file with coordinates for d3o15a_.
(The format of our PDB-style files is described here.)

Timeline for d3o15a_: