Lineage for d3o16a_ (3o16 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414817Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) (S)
    automatically mapped to Pfam PF02581
  5. 2414818Family c.1.3.1: Thiamin phosphate synthase [51392] (2 protein domains)
  6. 2414841Protein automated matches [196298] (1 species)
    not a true protein
  7. 2414842Species Bacillus subtilis [TaxId:1423] [196299] (1 PDB entry)
  8. 2414843Domain d3o16a_: 3o16 A: [196300]
    automated match to d2tpsa_

Details for d3o16a_

PDB Entry: 3o16 (more details), 2.1 Å

PDB Description: crystal structure of bacillus subtilis thiamin phosphate synthase k159a
PDB Compounds: (A:) Thiamine-phosphate pyrophosphorylase

SCOPe Domain Sequences for d3o16a_:

Sequence, based on SEQRES records: (download)

>d3o16a_ c.1.3.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
trisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearikf
aekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvsahtm
sevkqaeedgadyvglgpiyptetakdtravqgvslieavrrqgisipivgiggitidna
apviqagadgvsmisaisqaedpesaarkfreeiqtykt

Sequence, based on observed residues (ATOM records): (download)

>d3o16a_ c.1.3.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
trisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearikf
aekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvsahtm
sevkqaeedgadyvglgpiyptvslieavrrqgisipivgiggitidnaapviqagadgv
smisaisqaedpesaarkfreeiqtykt

SCOPe Domain Coordinates for d3o16a_:

Click to download the PDB-style file with coordinates for d3o16a_.
(The format of our PDB-style files is described here.)

Timeline for d3o16a_: