|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold | 
|  | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)  long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 | 
|  | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) | 
|  | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) | 
|  | Species Cow (Bos taurus) [TaxId:9913] [48673] (18 PDB entries) | 
|  | Domain d1gotg_: 1got G: [19629] Other proteins in same PDB: d1gota1, d1gota2, d1gotb_ complexed with gdp | 
PDB Entry: 1got (more details), 2 Å
SCOPe Domain Sequences for d1gotg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gotg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
ltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfke
Timeline for d1gotg_: