| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() |
| Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
| Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81412] (24 PDB entries) |
| Domain d3asov_: 3aso V: [196285] Other proteins in same PDB: d3asoc_, d3asof_, d3asog_, d3ason_, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asow_, d3asox_, d3asoy_, d3asoz_ automated match to d3ag3i_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3aso (more details), 2.3 Å
SCOPe Domain Sequences for d3asov_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asov_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak
Timeline for d3asov_: