SCOPe 2.03: Domain d3asox_: 3aso X:

Lineage for d3asox_ (3aso X:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein automated matches [190272] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187064] (16 PDB entries)

8. Domain d3asox_: 3aso X: [196283]
   Other proteins in same PDB: d3asoa_, d3asob1, d3asob2, d3asoc_, d3asod_, d3asoe_, d3asof_, d3asog_, d3asoh_, d3asoi_, d3asoj_, d3asok_, d3asol_, d3asom_, d3ason_, d3asoo1, d3asoo2, d3asop_, d3asoq_, d3asor_, d3asos_, d3asot_, d3asou_, d3asov_, d3asow_, d3asoy_, d3asoz_
   automated match to d1v54k_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asox_

PDB Entry: 3aso, 2.3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 0.9 angstrom wavelength

PDB Compounds: (X:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d3asox_:

Sequence; same for both SEQRES and ATOM records:

>d3asox_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d3asox_:

• d3asox_ first appeared in SCOPe 2.02
  
• d3asox_ appears in SCOPe 2.04
  
• d3asox_ appears in the current release, SCOPe 2.08