Lineage for d3nwea_ (3nwe A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1864484Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 1864495Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 1864507Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (23 PDB entries)
  8. 1864514Domain d3nwea_: 3nwe A: [196281]
    automated match to d3u81a_
    protein/RNA complex; complexed with 662, cl, mg, nhe, so4

Details for d3nwea_

PDB Entry: 3nwe (more details), 1.5 Å

PDB Description: rat comt in complex with a methylated desoxyribose bisubstrate- containing inhibitor avoids hydroxyl group
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d3nwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nwea_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d3nwea_:

Click to download the PDB-style file with coordinates for d3nwea_.
(The format of our PDB-style files is described here.)

Timeline for d3nwea_: