Class a: All alpha proteins [46456] (258 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies) not a true fold |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (1 protein) |
Protein Methanol dehydrogenase, light chain [48668] (3 species) |
Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (5 PDB entries) |
Domain d1g72d_: 1g72 D: [19628] Other proteins in same PDB: d1g72a_, d1g72c_ complexed with ca, pqq |
PDB Entry: 1g72 (more details), 1.9 Å
SCOP Domain Sequences for d1g72d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g72d_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian
Timeline for d1g72d_: