SCOP 1.73: Domain d1g72d_: 1g72 D:

Lineage for d1g72d_ (1g72 D:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (1 protein)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (5 PDB entries)

8. Domain d1g72d_: 1g72 D: [19628]
   Other proteins in same PDB: d1g72a_, d1g72c_
   complexed with ca, pqq

Details for d1g72d_

PDB Entry: 1g72, 1.9 Å

PDB Description: catalytic mechanism of quinoprotein methanol dehydrogenase: a theoretical and x-ray crystallographic investigation

PDB Compounds: (D:) methanol dehydrogenase light subunit

SCOP Domain Sequences for d1g72d_:

Sequence; same for both SEQRES and ATOM records:

>d1g72d_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian

Timeline for d1g72d_:

• d1g72d_ first appeared (with stable ids) in SCOP 1.55
  
• d1g72d_ appears in SCOP 1.71
  
• d1g72d_ appears in SCOP 1.75
  
• d1g72d_ appears in the current release, SCOPe 2.08