SCOPe 2.08: Domain d3nxjb_: 3nxj B:

Lineage for d3nxjb_ (3nxj B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)

7. Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (23 PDB entries)

8. Domain d3nxjb_: 3nxj B: [196278]
   automated match to d3nhxa_
   complexed with so4

Details for d3nxjb_

PDB Entry: 3nxj, 1.97 Å

PDB Description: crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi)

PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d3nxjb_:

Sequence; same for both SEQRES and ATOM records:

>d3nxjb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaairefyanslk
lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
ihaga

Timeline for d3nxjb_:

• d3nxjb_ first appeared in SCOPe 2.02
  
• d3nxjb_ appears in SCOPe 2.07