SCOP 1.75: Domain d1g72b_: 1g72 B:

Lineage for d1g72b_ (1g72 B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (1 protein)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (5 PDB entries)

8. Domain d1g72b_: 1g72 B: [19627]
   Other proteins in same PDB: d1g72a_, d1g72c_

Details for d1g72b_

PDB Entry: 1g72, 1.9 Å

PDB Description: catalytic mechanism of quinoprotein methanol dehydrogenase: a theoretical and x-ray crystallographic investigation

PDB Compounds: (B:) methanol dehydrogenase light subunit

SCOP Domain Sequences for d1g72b_:

Sequence; same for both SEQRES and ATOM records:

>d1g72b_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian

Timeline for d1g72b_:

• d1g72b_ first appeared (with stable ids) in SCOP 1.55
  
• d1g72b_ appears in SCOP 1.73
  
• d1g72b_ appears in SCOPe 2.01
  
• d1g72b_ appears in the current release, SCOPe 2.08