| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) ![]() consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
| Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
| Protein Methanol dehydrogenase, light chain [48668] (3 species) |
| Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries) |
| Domain d1g72b_: 1g72 B: [19627] Other proteins in same PDB: d1g72a_, d1g72c_ complexed with ca, pqq |
PDB Entry: 1g72 (more details), 1.9 Å
SCOPe Domain Sequences for d1g72b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g72b_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian
Timeline for d1g72b_: