Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (13 species) not a true protein |
Species Mycobacterium marinum [TaxId:216594] [196268] (1 PDB entry) |
Domain d3swtb_: 3swt B: [196269] automated match to d3r1jb_ complexed with edo, fe, peg |
PDB Entry: 3swt (more details), 2.05 Å
SCOPe Domain Sequences for d3swtb_:
Sequence, based on SEQRES records: (download)
>d3swtb_ b.82.2.0 (B:) automated matches {Mycobacterium marinum [TaxId: 216594]} litvkklgsrigaqvdgvslgadldaaavdqiraallehkviffrnqhhlddqqqlqfag llgtpighpaaaaalpdapiitpinsewgkanrwhtdvtfaanypaasilravtlpnygg stlwantatayaelpeplkclvenlwalhtnrydyvaneavqaltdtqqafrqafqkpdf rtehpvvrvhpetgertllagdfvrgfvgldsqessalfellqrritspentirwnwesg dvaiwdnratqhraiddyddqhrllhrvtlmgdvpvdvhgqrsrvisgaplala
>d3swtb_ b.82.2.0 (B:) automated matches {Mycobacterium marinum [TaxId: 216594]} litvkklgsrigaqvdgvslgadldaaavdqiraallehkviffrnqhhlddqqqlqfag llgtpighnrwhtdvtfaanypaasilravtlpnyggstlwantatayaelpeplkclve nlwalhtnrpdfrtehpvvrvhpetgertllagdfvrgfvgldsqessalfellqrrits pentirwnwesgdvaiwdnratqhraiddyddqhrllhrvtlmgdvpvdvhgqrsrvisg aplala
Timeline for d3swtb_: