SCOPe 2.08: Domain d3sxwa1: 3sxw A:3-189

Lineage for d3sxwa1 (3sxw A:3-189)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
   automatically mapped to Pfam PF06560

6. Protein automated matches [196263] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries)

8. Domain d3sxwa1: 3sxw A:3-189 [196265]
   Other proteins in same PDB: d3sxwa2
   automated match to d1x82a_

Details for d3sxwa1

PDB Entry: 3sxw, 1.8 Å

PDB Description: Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR69.

PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d3sxwa1:

Sequence; same for both SEQRES and ATOM records:

>d3sxwa1 b.82.1.7 (A:3-189) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfsthviypgkvgkefffakghfhakldraqvavalkgkggvlmqtpegdakwi
ssepgtviysppywaaravnigdepfimlviypadaghdygtiaekgfskivieengevk
vvdnprw

Timeline for d3sxwa1:

• d3sxwa1 first appeared in SCOPe 2.02, called d3sxwa_
  
• d3sxwa1 appears in SCOPe 2.07