SCOPe 2.07: Domain d3syxa1: 3syx A:13-127

Lineage for d3syxa1 (3syx A:13-127)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)

6. Protein Sprouty-related, EVH1 domain-containing protein 1, Spred-1 [141430] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [196261] (3 PDB entries)

8. Domain d3syxa1: 3syx A:13-127 [196262]
   Other proteins in same PDB: d3syxa2
   automated match to d1xoda1
   complexed with yt3

Details for d3syxa1

PDB Entry: 3syx, 2.45 Å

PDB Description: Crystal Structure of the WH1 domain from human sprouty-related, EVH1 domain-containing protein. Northeast Structural Genomics Consortium Target HR5538B.

PDB Compounds: (A:) Sprouty-related, EVH1 domain-containing protein 1

SCOPe Domain Sequences for d3syxa1:

Sequence; same for both SEQRES and ATOM records:

>d3syxa1 b.55.1.4 (A:13-127) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Human (Homo sapiens) [TaxId: 9606]}
syarvravvmtrddssggwlplggsglssvtvfkvphqeengcadffirgerlrdkmvvl
ecmlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedisqgc

Timeline for d3syxa1:

• d3syxa1 first appeared in SCOPe 2.02, called d3syxa_
  
• d3syxa1 appears in SCOPe 2.06
  
• d3syxa1 appears in the current release, SCOPe 2.08