SCOPe 2.05: Domain d3syxa_: 3syx A:

Lineage for d3syxa_ (3syx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)

6. Protein Sprouty-related, EVH1 domain-containing protein 1, Spred-1 [141430] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [196261] (1 PDB entry)

8. Domain d3syxa_: 3syx A: [196262]
   automated match to d1xoda1
   complexed with yt3

Details for d3syxa_

PDB Entry: 3syx, 2.45 Å

PDB Description: Crystal Structure of the WH1 domain from human sprouty-related, EVH1 domain-containing protein. Northeast Structural Genomics Consortium Target HR5538B.

PDB Compounds: (A:) Sprouty-related, EVH1 domain-containing protein 1

SCOPe Domain Sequences for d3syxa_:

Sequence; same for both SEQRES and ATOM records:

>d3syxa_ b.55.1.4 (A:) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Human (Homo sapiens) [TaxId: 9606]}
shmsyarvravvmtrddssggwlplggsglssvtvfkvphqeengcadffirgerlrdkm
vvlecmlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedisqgc

Timeline for d3syxa_:

• d3syxa_ first appeared in SCOPe 2.02
  
• d3syxa_ appears in SCOPe 2.04
  
• d3syxa_ is called d3syxa1 in SCOPe 2.06
  
• d3syxa_ appears in the current release, SCOPe 2.08, called d3syxa1