SCOPe 2.05: Domain d2xo2a_: 2xo2 A:

Lineage for d2xo2a_ (2xo2 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (10 proteins)

6. Protein automated matches [190368] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188886] (3 PDB entries)

8. Domain d2xo2a_: 2xo2 A: [196259]
   automated match to d1anwa_
   complexed with ca, cl, na, so4

Details for d2xo2a_

PDB Entry: 2xo2, 2.8 Å

PDB Description: human annexin v with incorporated methionine analogue azidohomoalanine

PDB Compounds: (A:) Annexin A5

SCOPe Domain Sequences for d2xo2a_:

Sequence; same for both SEQRES and ATOM records:

>d2xo2a_ a.65.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvlrgtvtdfpgfderadaetlrkaxkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalxkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrxlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkyxtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyaxkgagtddhtlirvxvsrseidlfnirkefrknfatslysxikg
dtsgdykkallllcgedd

Timeline for d2xo2a_:

• d2xo2a_ first appeared in SCOPe 2.02
  
• d2xo2a_ appears in SCOPe 2.04
  
• d2xo2a_ appears in SCOPe 2.06
  
• d2xo2a_ appears in the current release, SCOPe 2.08