Lineage for d2xo2a_ (2xo2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717186Protein automated matches [190368] (3 species)
    not a true protein
  7. 2717189Species Human (Homo sapiens) [TaxId:9606] [188886] (10 PDB entries)
  8. 2717201Domain d2xo2a_: 2xo2 A: [196259]
    automated match to d1anwa_
    complexed with ca, cl, na, so4

Details for d2xo2a_

PDB Entry: 2xo2 (more details), 2.8 Å

PDB Description: human annexin v with incorporated methionine analogue azidohomoalanine
PDB Compounds: (A:) Annexin A5

SCOPe Domain Sequences for d2xo2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xo2a_ a.65.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvlrgtvtdfpgfderadaetlrkaxkglgtdeesiltlltsrsnaqrqeisaafktlfg
rdllddlkseltgkfeklivalxkpsrlydayelkhalkgagtnekvlteiiasrtpeel
raikqvyeeeygssleddvvgdtsgyyqrxlvvllqanrdpdagideaqveqdaqalfqa
gelkwgtdeekfitifgtrsvshlrkvfdkyxtisgfqieetidretsgnleqlllavvk
sirsipaylaetlyyaxkgagtddhtlirvxvsrseidlfnirkefrknfatslysxikg
dtsgdykkallllcgedd

SCOPe Domain Coordinates for d2xo2a_:

Click to download the PDB-style file with coordinates for d2xo2a_.
(The format of our PDB-style files is described here.)

Timeline for d2xo2a_: