![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
![]() | Superfamily a.65.1: Annexin [47874] (2 families) ![]() duplication: consists of four domains of the same fold |
![]() | Family a.65.1.1: Annexin [47875] (10 proteins) |
![]() | Protein automated matches [190368] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188886] (10 PDB entries) |
![]() | Domain d2xo2a_: 2xo2 A: [196259] automated match to d1anwa_ complexed with ca, cl, na, so4 |
PDB Entry: 2xo2 (more details), 2.8 Å
SCOPe Domain Sequences for d2xo2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xo2a_ a.65.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvlrgtvtdfpgfderadaetlrkaxkglgtdeesiltlltsrsnaqrqeisaafktlfg rdllddlkseltgkfeklivalxkpsrlydayelkhalkgagtnekvlteiiasrtpeel raikqvyeeeygssleddvvgdtsgyyqrxlvvllqanrdpdagideaqveqdaqalfqa gelkwgtdeekfitifgtrsvshlrkvfdkyxtisgfqieetidretsgnleqlllavvk sirsipaylaetlyyaxkgagtddhtlirvxvsrseidlfnirkefrknfatslysxikg dtsgdykkallllcgedd
Timeline for d2xo2a_: