Lineage for d2xr4b_ (2xr4 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141195Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 1141196Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 1141289Family b.115.1.0: automated matches [191398] (1 protein)
    not a true family
  6. 1141290Protein automated matches [190521] (2 species)
    not a true protein
  7. 1141291Species Burkholderia cenocepacia [TaxId:216591] [188413] (5 PDB entries)
  8. 1141302Domain d2xr4b_: 2xr4 B: [196258]
    automated match to d2bv4a_
    complexed with so4

Details for d2xr4b_

PDB Entry: 2xr4 (more details), 1.9 Å

PDB Description: c-terminal domain of bc2l-c lectin from burkholderia cenocepacia
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2xr4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xr4b_ b.115.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
merdgtfnlpphikfgvtalthaandqtidiyidddpkpaatfkgagaqdqnlgtkvlds
gngrvrvivmangrpsrlgsrqvdifkksyfgiigsedgadddyndgivflnwplg

SCOPe Domain Coordinates for d2xr4b_:

Click to download the PDB-style file with coordinates for d2xr4b_.
(The format of our PDB-style files is described here.)

Timeline for d2xr4b_: