![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
![]() | Protein automated matches [190030] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries) |
![]() | Domain d2y9ua_: 2y9u A: [196257] automated match to d1rg6a_ complexed with so4; mutant |
PDB Entry: 2y9u (more details), 1.6 Å
SCOPe Domain Sequences for d2y9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y9ua_ a.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwkgildh rqlhefs
Timeline for d2y9ua_: