Lineage for d2y9ua_ (2y9u A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715544Protein automated matches [190030] (2 species)
    not a true protein
  7. 2715545Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)
  8. 2715546Domain d2y9ua_: 2y9u A: [196257]
    automated match to d1rg6a_
    complexed with so4; mutant

Details for d2y9ua_

PDB Entry: 2y9u (more details), 1.6 Å

PDB Description: structural basis of p63a sam domain mutants involved in aec syndrome
PDB Compounds: (A:) Tumor protein 63

SCOPe Domain Sequences for d2y9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y9ua_ a.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwkgildh
rqlhefs

SCOPe Domain Coordinates for d2y9ua_:

Click to download the PDB-style file with coordinates for d2y9ua_.
(The format of our PDB-style files is described here.)

Timeline for d2y9ua_: