Class b: All beta proteins [48724] (174 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) |
Protein automated matches [190077] (14 species) not a true protein |
Species Moniliophthora perniciosa [TaxId:153609] [189814] (2 PDB entries) |
Domain d3o7ta_: 3o7t A: [196252] automated match to d3pmpa_ |
PDB Entry: 3o7t (more details), 1.85 Å
SCOPe Domain Sequences for d3o7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o7ta_ b.62.1.1 (A:) automated matches {Moniliophthora perniciosa [TaxId: 153609]} shmanvffnisindkpegrivfklydeavpktaknfrelatgqhgfgykdsifhrvipqf mlqggdftrhngtggksiygekfadenfqvkhtkpgllsmanagantngsqffittvpts wldgkhvvfgeviegldivrkvegkgsasgktnatikitdcgtv
Timeline for d3o7ta_: