Lineage for d3o7ta_ (3o7t A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134137Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1134138Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1134139Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 1134360Protein automated matches [190077] (14 species)
    not a true protein
  7. 1134393Species Moniliophthora perniciosa [TaxId:153609] [189814] (2 PDB entries)
  8. 1134396Domain d3o7ta_: 3o7t A: [196252]
    automated match to d3pmpa_

Details for d3o7ta_

PDB Entry: 3o7t (more details), 1.85 Å

PDB Description: Crystal Structure of Cyclophilin A from Moniliophthora perniciosa
PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d3o7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o7ta_ b.62.1.1 (A:) automated matches {Moniliophthora perniciosa [TaxId: 153609]}
shmanvffnisindkpegrivfklydeavpktaknfrelatgqhgfgykdsifhrvipqf
mlqggdftrhngtggksiygekfadenfqvkhtkpgllsmanagantngsqffittvpts
wldgkhvvfgeviegldivrkvegkgsasgktnatikitdcgtv

SCOPe Domain Coordinates for d3o7ta_:

Click to download the PDB-style file with coordinates for d3o7ta_.
(The format of our PDB-style files is described here.)

Timeline for d3o7ta_: