SCOPe 2.08: Domain d3puxe1: 3pux E:1-370

Lineage for d3puxe1 (3pux E:1-370)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189211] (10 PDB entries)

8. Domain d3puxe1: 3pux E:1-370 [196250]
   Other proteins in same PDB: d3puxa1, d3puxa2, d3puxa3, d3puxb1, d3puxb2, d3puxe2, d3puxf1, d3puxf2, d3puxg_
   automated match to d3rlfe_
   complexed with adp, bef, mg, pgv, umq

Details for d3puxe1

PDB Entry: 3pux, 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3

PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3puxe1:

Sequence; same for both SEQRES and ATOM records:

>d3puxe1 c.94.1.1 (E:1-370) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

Timeline for d3puxe1:

• d3puxe1 first appeared in SCOPe 2.02, called d3puxe_
  
• d3puxe1 appears in SCOPe 2.07