Lineage for d3r0ed_ (3r0e D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422814Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2422815Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2422867Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 2422868Protein automated matches [190587] (7 species)
    not a true protein
  7. 2422937Species Remusatia vivipara [TaxId:189456] [193663] (1 PDB entry)
  8. 2422941Domain d3r0ed_: 3r0e D: [196249]
    automated match to d3mezb_

Details for d3r0ed_

PDB Entry: 3r0e (more details), 2.4 Å

PDB Description: Structure of Remusatia vivipara lectin
PDB Compounds: (D:) lectin

SCOPe Domain Sequences for d3r0ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0ed_ b.78.1.0 (D:) automated matches {Remusatia vivipara [TaxId: 189456]}
nipftnnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
nhkgeliikdddfktiwssrssskqgeyvlilqddgfgviygpaifetss

SCOPe Domain Coordinates for d3r0ed_:

Click to download the PDB-style file with coordinates for d3r0ed_.
(The format of our PDB-style files is described here.)

Timeline for d3r0ed_: